• Gene id: 10001

Gene Summary

• Gene Symbol: MED6   Gene   UCSC   Ensembl
• Aliases: ARC33, NY-REN-28
• Gene name: mediator complex subunit 6
• Alternate names: mediator of RNA polymerase II transcription subunit 6, CTD-2540L5.5, activator-recruited cofactor 33 kDa component, renal carcinoma antigen NY-REN-28,
• Gene location: 14q24.2 (70600689: 70583220)     Exons: 9     NC_000014.9
• OMIM: 602984

Protein Summary

• Protein general information: O75586  
  • Name: Mediator of RNA polymerase II transcription subunit 6 (Activator recruited cofactor 33 kDa component) (ARC33) (Mediator complex subunit 6) (hMed6) (Renal carcinoma antigen NY REN 28)
  • Length: 246  
  • Mass: 28425
• Sequence:

  MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQE
  PILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFK
  DHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKET
  TKNVQQTVSAKGPPEKRMRLQ

• Structural information:
  • Interpro: IPR038566  IPR007018  IPR016820  
  • DIP: 31456
  • STRING: ENSP00000481920
• Other Databases: GeneCards:  MED6  Malacards:  MED6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0070847	core mediator complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0016592	mediator complex	TAS	cellular component
GO:0016592	mediator complex	IDA	cellular component
GO:0016592	mediator complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0008134	transcription factor binding	IPI	molecular function
GO:0016592	mediator complex	IMP	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881