• Gene id: 10000

Gene Summary

• Gene Symbol: AKT3   Gene   UCSC   Ensembl
• Aliases: MPPH, MPPH2, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2
• Gene name: AKT serine/threonine kinase 3
• Alternate names: RAC-gamma serine/threonine-protein kinase, PKB gamma, RAC-gamma serine/threonine protein kinase, v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma),
• Gene location: 1q43-q44 (129861513: 129831243)     Exons: 6     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of b
• OMIM: 611223

Protein Summary

• Protein general information: Q9Y243  
  • Name: RAC gamma serine/threonine protein kinase (EC 2.7.11.1) (Protein kinase Akt 3) (Protein kinase B gamma) (PKB gamma) (RAC PK gamma) (STK 2)
  • Length: 479  
  • Mass: 55775
  • Tissue specificity: In adult tissues, it is highly expressed in brain, lung and kidney, but weakly in heart, testis and liver. In fetal tissues, it is highly expressed in heart, liver and brain and not at all in kidney.
• Sequence:

  MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIR
  CLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDY
  LKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVM
  EYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
  ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKS
  LLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPE
  KYDEDGMDCMDNERRPHFPQFSYSASGRE

• Structural information:
  • Protein Domains: (5..10-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (148..40-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (406..47-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR034675  IPR011009  IPR011993  IPR001849   IPR039026  IPR017892  IPR000719  IPR017441  IPR039029  IPR008271  
  • Prosite: PS51285 PS50003 PS00107 PS50011 PS00108
  • CDD: cd01241 cd05593
  • PDB: 2X18
  • PDBsum: 2X18
  • DIP: 32584
  • STRING: ENSP00000263826
• Other Databases: GeneCards:  AKT3  Malacards:  AKT3

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05017	Spinocerebellar ataxia
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa05152	Tuberculosis
hsa04932	Non-alcoholic fatty liver disease
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04380	Osteoclast differentiation
hsa05160	Hepatitis C
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa04922	Glucagon signaling pathway
hsa05231	Choline metabolism in cancer
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04620	Toll-like receptor signaling pathway
hsa04066	HIF-1 signaling pathway
hsa05145	Toxoplasmosis
hsa04662	B cell receptor signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa05222	Small cell lung cancer
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa05214	Glioma
hsa04920	Adipocytokine signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05211	Renal cell carcinoma
hsa05218	Melanoma
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04370	VEGF signaling pathway
hsa05213	Endometrial cancer
hsa04923	Regulation of lipolysis in adipocytes
hsa05230	Central carbon metabolism in cancer
hsa01524	Platinum drug resistance
hsa04973	Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome	KEGG:H01885
Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome	KEGG:H01885
Prostate cancer	PMID:22546513
colon cancer	PMID:20811704
prostate adenocarcinoma	PMID:20638364
Glioblastoma multiforme	PMID:27422127
Astrocytoma	PMID:20167810
lung non-small cell carcinoma	PMID:19846969
pancreatic adenocarcinoma	PMID:27919956
renal cell carcinoma	PMID:23378641
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R