• Gene id: 9967

Gene Summary

• Gene Symbol: THRAP3   Gene   UCSC   Ensembl
• Aliases: BCLAF2, TRAP150
• Gene name: thyroid hormone receptor associated protein 3
• Alternate names: thyroid hormone receptor-associated protein 3, BCLAF1 and THRAP3 family member 2, TR-associated protein, 150-kDa, thyroid hormone receptor-associated protein complex 150 kDa component, thyroid hormone receptor-associated protein, 150 kDa subunit,
• Gene location: 1p34.3 (36224428: 36305356)     Exons: 15     NC_000001.11
• OMIM: 190020

Protein Summary

• Protein general information: Q9Y2W1  
  • Name: Thyroid hormone receptor associated protein 3 (BCLAF1 and THRAP3 family member 2) (Thyroid hormone receptor associated protein complex 150 kDa component) (Trap150)
  • Length: 955  
  • Mass: 108666
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSLSRSRKRRLSSRSRSRSYSPAHNRERNHPRVYQNRDFRG
  HNRGYRRPYYFRGRNRGFYPWGQYNRGGYGNYRSNWQNYRQAYSPRRGRSRSRSPKRRSPSPRSRSHSRNSDKSS
  SDRSRRSSSSRSSSNHSRVESSKRKSAKEKKSSSKDSRPSQAAGDNQGDEAKEQTFSGGTSQDTKASESSKPWPD
  ATYGTGSASRASAVSELSPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSSTSQMGSTLPSGAGYQSGTHQG
  QFDHGSGSLSPSKKSPVGKSPPSTGSTYGSSQKEESAASGGAAYTKRYLEEQKTENGKDKEQKQTNTDKEKIKEK
  GSFSDTGLGDGKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADFHKEEMDDQDKDKAKGRKESEFDDEP
  KFMSKVIGANKNQEEEKSGKWEGLVYAPPGKEKQRKTEELEEESFPERSKKEDRGKRSEGGHRGFVPEKNFRVTA
  YKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGLLAQERKLCRDLVHS
  NKKEQEFRSIFQHIQSAQSQRSPSELFAQHIVTIVHHVKEHHFGSSGMTLHERFTKYLKRGTEQEAAKNKKSPEI
  HRRIDISPSTFRKHGLAHDEMKSPREPGYKAEGKYKDDPVDLRLDIERRKKHKERDLKRGKSRESVDSRDSSHSR
  ERSAEKTEKTHKGSKKQKKHRRARDRSRSSSSSSQSSHSYKAEEYTEETEEREESTTGFDKSRLGTKDFVGPSER
  GGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRG
  RGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDNIQPTTE

• Structural information:
  • Interpro: IPR026667  IPR029199  
  • STRING: ENSP00000346634
• Other Databases: GeneCards:  THRAP3  Malacards:  THRAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0003677	DNA binding	IBA	molecular function
GO:0016592	mediator complex	IBA	cellular component
GO:0051219	phosphoprotein binding	IDA	molecular function
GO:0035145	exon-exon junction complex	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0000956	nuclear-transcribed mRNA catabolic process	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0042753	positive regulation of circadian rhythm	IMP	biological process
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IMP	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0048255	mRNA stabilization	IMP	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0016592	mediator complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0016592	mediator complex	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0016592	mediator complex	IDA	cellular component
GO:0046966	thyroid hormone receptor binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003712	transcription coregulator activity	IDA	molecular function
GO:0042809	vitamin D receptor binding	NAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq