• Gene id: 9966

Gene Summary

• Gene Symbol: TNFSF15   Gene   UCSC   Ensembl
• Aliases: TL1, TL1A, TNLG1B, VEGI, VEGI192A
• Gene name: TNF superfamily member 15
• Alternate names: tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand 1B, tumor necrosis factor superfamily member 15, vascular endothe,
• Gene location: 9q32 (201451576: 201377206)     Exons: 17     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducib
• OMIM: 604052

Protein Summary

• Protein general information: O95150  
  • Name: Tumor necrosis factor ligand superfamily member 15 (TNF ligand related molecule 1) (Vascular endothelial cell growth inhibitor) [Cleaved into: Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily memb
  • Length: 251  
  • Mass: 28087
  • Tissue specificity: Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. {ECO
• Sequence:

  MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQ
  EFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIY
  SQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDK
  LMVNVSDISLVDYTKEDKTFFGAFLL

• Structural information:
  • Interpro: IPR006053  IPR006052  IPR008064  IPR008983  
  • Prosite: PS50049
  • CDD: cd00184
  • PDB: 2O0O 2QE3 2RE9 2RJK 2RJL 3K51 3MI8
  • PDBsum: 2O0O 2QE3 2RE9 2RJK 2RJL 3K51 3MI8
  • DIP: 59562
  • STRING: ENSP00000363157
• Other Databases: GeneCards:  TNFSF15  Malacards:  TNFSF15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0042107	cytokine metabolic process	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Crohn disease	KEGG:H00286
Crohn disease	KEGG:H00286
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881