• Gene id: 9960

Gene Summary

• Gene Symbol: USP3   Gene   UCSC   Ensembl
• Aliases: SIH003, UBP
• Gene name: ubiquitin specific peptidase 3
• Alternate names: ubiquitin carboxyl-terminal hydrolase 3, deubiquitinating enzyme 3, ubiquitin thioesterase 3, ubiquitin thiolesterase 3, ubiquitin-specific-processing protease 3,
• Gene location: 15q22.31 (63504510: 63594639)     Exons: 21     NC_000015.10
• OMIM: 604728

Protein Summary

• Protein general information: Q9Y6I4  
  • Name: Ubiquitin carboxyl terminal hydrolase 3 (EC 3.4.19.12) (Deubiquitinating enzyme 3) (Ubiquitin thioesterase 3) (Ubiquitin specific processing protease 3)
  • Length: 520  
  • Mass: 58897
  • Tissue specificity: Expressed in all tissues examined, with strongest expression in pancreas.
• Sequence:

  MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSE
  KQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVN
  GSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKT
  LCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
  CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLE
  ELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSGPE
  SCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL

• Structural information:
  • Protein Domains: (159..51-)
    (/note="USP"-)
  • Interpro: IPR038765  IPR001394  IPR018200  IPR028889  IPR013083   IPR001607  
  • Prosite: PS00972 PS00973 PS50235 PS50271
  • DIP: 53585
  • STRING: ENSP00000369681
• Other Databases: GeneCards:  USP3  Malacards:  USP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016578	histone deubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0031647	regulation of protein stability	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0016578	histone deubiquitination	IDA	biological process
GO:0042393	histone binding	IPI	molecular function
GO:0006281	DNA repair	IMP	biological process
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)