Search Result
| Gene id | 9957 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | HS3ST1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | 3OST, 3OST1 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | heparan sulfate-glucosamine 3-sulfotransferase 1 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | heparan sulfate glucosamine 3-O-sulfotransferase 1, 3-OST-1, h3-OST-1, heparan sulfate (glucosamine) 3-O-sulfotransferase 1, heparan sulfate 3-O-sulfotransferase 1, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1, heparin-glucosamine 3-O-sulfotransferase, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
4p15.33 (11434397: 11393149) Exons: 3 NC_000004.12 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 182891 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O14792 Name: Heparan sulfate glucosamine 3 O sulfotransferase 1 (EC 2.8.2.23) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 1) (3 OST 1) (Heparan sulfate 3 O sulfotransferase 1) (h3 OST 1) Length: 307 Mass: 35773 Tissue specificity: Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta. {ECO | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLS LHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPS ERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPF PEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV GRTFDWH | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: HS3ST1  Malacards: HS3ST1 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||