Search Result
| Gene id | 9956 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | HS3ST2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | 30ST2, 3OST2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | heparan sulfate-glucosamine 3-sulfotransferase 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | heparan sulfate glucosamine 3-O-sulfotransferase 2, 3-OST-2, h3-OST-2, heparan sulfate (glucosamine) 3-O-sulfotransferase 2, heparan sulfate 3-O-sulfotransferase 2, heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2, heparin-glucosamine 3-O-sulfotransferase, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
16p12.2 (22814161: 22916337) Exons: 4 NC_000016.10 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 604056 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9Y278 Name: Heparan sulfate glucosamine 3 O sulfotransferase 2 (EC 2.8.2.29) (Heparan sulfate D glucosaminyl 3 O sulfotransferase 2) (3 OST 2) (Heparan sulfate 3 O sulfotransferase 2) (h3 OST 2) Length: 367 Mass: 41501 Tissue specificity: Highly expressed in the brain and weakly expressed in the heart, placenta, lung and skeletal muscle. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQKSRPCDP SGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFF DRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDI PTFEGLSFRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITDPAGEMGRVQDFLGIKRFITD KHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: HS3ST2  Malacards: HS3ST2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||