• Gene id: 9946

Gene Summary

• Gene Symbol: CRYZL1   Gene   UCSC   Ensembl
• Aliases: 4P11, QOH-1
• Gene name: crystallin zeta like 1
• Alternate names: quinone oxidoreductase-like protein 1, crystallin, zeta (quinone reductase)-like 1, protein 4P11, quinone oxidoreductase homolog 1, quinone reductase-like 1, zeta-crystallin homolog,
• Gene location: 21q22.11 (33641740: 33589340)     Exons: 6     NC_000021.9
• Gene summary(Entrez): This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but th
• OMIM: 603920

Protein Summary

• Protein general information: O95825  
  • Name: Quinone oxidoreductase like protein 1 (EC 1. . . ) (Protein 4P11) (Quinone oxidoreductase homolog 1) (QOH 1) (Zeta crystallin homolog)
  • Length: 349  
  • Mass: 38697
  • Tissue specificity: Ubiquitous.
• Sequence:

  MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLDVGS
  KVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLSHLSPGKSVLI
  MDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCLEETGGLGVDIVLDAG
  VRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVWNLSNVQQGKY
  LCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF

• Structural information:
  • Interpro: IPR042633  IPR011032  IPR036291  IPR020843  
  • DIP: 62115
  • STRING: ENSP00000370966
• Other Databases: GeneCards:  CRYZL1  Malacards:  CRYZL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:1901661	quinone metabolic process	NAS	biological process
GO:0005829	cytosol	HDA	cellular component
GO:0003960	NADPH:quinone reductase activity	NAS	molecular function
GO:0050661	NADP binding	NAS	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray