• Gene id: 9938

Gene Summary

• Gene Symbol: ARHGAP25   Gene   UCSC   Ensembl
• Aliases: HEL-S-308, KAIA0053
• Gene name: Rho GTPase activating protein 25
• Alternate names: rho GTPase-activating protein 25, epididymis secretory protein Li 308, epididymis secretory sperm binding protein, rho-type GTPase-activating protein 25,
• Gene location: 2p13.3 (68710509: 68826844)     Exons: 18     NC_000002.12
• Gene summary(Entrez): ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM, Mar 2008]
• OMIM: 600589

Protein Summary

• Protein general information: P42331  
  • Name: Rho GTPase activating protein 25 (Rho type GTPase activating protein 25)
  • Length: 645  
  • Mass: 73435
• Sequence:

  MSLKLPRNWDFNLKVEAAKIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQL
  YYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVA
  GTPCGVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRD
  TDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQL
  NCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPV
  ARSSVGWDATEDLRISRTDSFSSMTSDSDTTSPTGQQPSDAFPEDSSKVPREKPGDWKMQSRKRTQTLPNRKCFL
  TSAFQGANSSKMEIFKNEFWSPSSEAKAGEGHRRTMSQDLRQLSDSQRTSTYDNVPSLPGSPGEEASALSSQACD
  SKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQELRKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELEKEK
  KKSAALEISLRNMERSREDVEKRNKALEEEVKEFVKSMKEPKTEA

• Structural information:
  • Protein Domains: (46..15-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (159..35-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR011993  IPR001849  IPR008936  IPR000198  
  • Prosite: PS50003 PS50238
  • PDB: 1V89
  • PDBsum: 1V89
  • STRING: ENSP00000386911
• Other Databases: GeneCards:  ARHGAP25  Malacards:  ARHGAP25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001891	phagocytic cup	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0051058	negative regulation of small GTPase mediated signal transduction	IBA	biological process
GO:0090630	activation of GTPase activity	IBA	biological process
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0006911	phagocytosis, engulfment	IBA	biological process
GO:0001891	phagocytic cup	IDA	cellular component
GO:0051058	negative regulation of small GTPase mediated signal transduction	IMP	biological process
GO:0007015	actin filament organization	IMP	biological process
GO:0006911	phagocytosis, engulfment	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray