• Gene id: 9914

Gene Summary

• Gene Symbol: ATP2C2   Gene   UCSC   Ensembl
• Aliases: SPCA2
• Gene name: ATPase secretory pathway Ca2+ transporting 2
• Alternate names: calcium-transporting ATPase type 2C member 2, ATPase 2C2, ATPase, Ca++ transporting, type 2C, member 2, secretory pathway Ca(2+)-ATPase 2, secretory pathway calcium ATPase 2,
• Gene location: 16q24.1 (84368522: 84465776)     Exons: 32     NC_000016.10
• OMIM: 116949

Protein Summary

• Protein general information: O75185  
  • Name: Calcium transporting ATPase type 2C member 2 (ATPase 2C2) (EC 7.2.2.10) (Secretory pathway Ca(2+) ATPase 2)
  • Length: 946  
  • Mass: 103169
• Sequence:

  MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHT
  GLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLGSALVSVLTKEYEDAVSIATAVLVVVTVAFI
  QEYRSEKSLEELTKLVPPECNCLREGKLQHLLARELVPGDVVSLSIGDRIPADIRLTEVTDLLVDESSFTGEAEP
  CSKTDSPLTGGGDLTTLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAEETPKTPLQKSMDRLGKQLTL
  FSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLGVLRMAKKRVIVKKLPIVETLGCCSV
  LCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPSKEVIKEFSNVSVGKLVEAGCVANNAVIRKN
  AVMGQPTEGALMALAMKMDLSDIKNSYIRKKEIPFSSEQKWMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNN
  GGIPLPLTPQQRSFCLQEEKRMGSLGLRVLALASGPELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMIT
  GDALETALAIGRNIGLCNGKLQAMSGEEVDSVEKGELADRVGKVSVFFRTSPKHKLKIIKALQESGAIVAMTGDG
  VNDAVALKSADIGIAMGQTGTDVSKEAANMILVDDDFSAIMNAVEEGKGIFYNIKNFVRFQLSTSISALSLITLS
  TVFNLPSPLNAMQILWINIIMDGPPAQSLGVEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFW
  KEMPEDRASTPRTTTMTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQ
  TENLGALDLLFLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV

• Structural information:
  • Interpro: IPR030334  IPR006068  IPR004014  IPR023299  IPR018303   IPR023298  IPR008250  IPR036412  IPR023214  IPR006413  IPR001757  
  • Prosite: PS00154
  • STRING: ENSP00000397925
• Other Databases: GeneCards:  ATP2C2  Malacards:  ATP2C2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015410	manganese transmembrane transporter activity, phosphorylative mechanism	IBA	molecular function
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IBA	molecular function
GO:0000139	Golgi membrane	IBA	cellular component
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0016887	ATPase activity	IBA	molecular function
GO:0008553	proton-exporting ATPase activity, phosphorylative mechanism	IBA	molecular function
GO:0006828	manganese ion transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IEA	molecular function
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0061180	mammary gland epithelium development	IEA	biological process
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0090280	positive regulation of calcium ion import	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq