• Gene id: 9906

Gene Summary

• Gene Symbol: SLC35E2A   Gene   UCSC   Ensembl
• Aliases: SLC35E2
• Gene name: solute carrier family 35 member E2A
• Alternate names: solute carrier family 35 member E2A, solute carrier family 35 member E2,
• Gene location: 1p36.33 (1745998: 1724837)     Exons: 8     NC_000001.11
• OMIM: 607627

Protein Summary

• Protein general information: P0CK97  
  • Name: Solute carrier family 35 member E2A
  • Length: 266  
  • Mass: 29079
• Sequence:

  MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGVWSSRA
  LLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPPNFLMTMLFVG
  LMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGRPSDREEREELQLQPGRGAAASDRRSPVP
  PSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLPAS

• Structural information:
  • Interpro: IPR004853  
  • STRING: ENSP00000246421
• Other Databases: GeneCards:  SLC35E2A  Malacards:  SLC35E2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0015297	antiporter activity	IBA	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0015297	antiporter activity	IBA	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881