• Gene id: 9867

Gene Summary

• Gene Symbol: PJA2   Gene   UCSC   Ensembl
• Aliases: Neurodap1, RNF131
• Gene name: praja ring finger ubiquitin ligase 2
• Alternate names: E3 ubiquitin-protein ligase Praja-2, RING-type E3 ubiquitin transferase Praja-2, praja 2, RING-H2 motif containing, praja ring finger 2, E3 ubiquitin protein ligase, praja2, ring finger protein 131,
• Gene location: 5q21.3 (109409977: 109334708)     Exons: 11     NC_000005.10

Protein Summary

• Protein general information: O43164  
  • Name: E3 ubiquitin protein ligase Praja 2 (Praja2) (EC 2.3.2.27) (RING finger protein 131) (RING type E3 ubiquitin transferase Praja 2)
  • Length: 708  
  • Mass: 78214
• Sequence:

  MSQYTEKEPAAMDQESGKAVWPKPAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDDVPKEN
  SSGSSPLDQVDSSLPSEPIFEKSETEIPTCGSALNQTTESSQSFVAVHHSEEGRDTLGSSTNLHNHSEGEYIPGA
  CSASSVQNGIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNTVFELENREAEAYTGLSPPVPSFNCE
  VRDEFEELDSVPLVKSSAGDTEFVHQNSQEIQRSSQDEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSEQNTN
  DREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMF
  LDPPYSRVITQRETENNQMTSESGATAGRQEVDNTFWNGCGDYYQLYDKDEDSSECSDGEWSASLPHRFSGTEKD
  QSSSDESWETLPGKDENEPELQSDSSGPEEENQELSLQEGEQTSLEEGEIPWLQYNEVNESSSDEGNEPANEFAQ
  PAFMLDGNNNLEDDSSVSEDLDVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVD
  VEVANPPASKESIDGLPETLVLEDHTAIGQEQCCPICCSEYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCR
  RHFPPAVIEASAAPSSEPDPDAPPSNDSIAEAP

• Structural information:
  • Interpro: IPR030639  IPR001841  IPR013083  
  • Prosite: PS50089
  • DIP: 47040
  • STRING: ENSP00000354775
• Other Databases: GeneCards:  PJA2  Malacards:  PJA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0016567	protein ubiquitination	IBA	biological process
GO:0010738	regulation of protein kinase A signaling	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IMP	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IMP	molecular function
GO:0007616	long-term memory	ISS	biological process
GO:1900745	positive regulation of p38MAPK cascade	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0034137	positive regulation of toll-like receptor 2 signaling pathway	IMP	biological process
GO:0010738	regulation of protein kinase A signaling	IMP	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0043030	regulation of macrophage activation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006954	inflammatory response	IMP	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0035329	hippo signaling	IEA	biological process
GO:0010738	regulation of protein kinase A signaling	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007616	long-term memory	IEA	biological process
GO:0010738	regulation of protein kinase A signaling	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)