• Gene id: 9811

Gene Summary

• Gene Symbol: CTIF   Gene   UCSC   Ensembl
• Aliases: Gm672, KIAA0427
• Gene name: cap binding complex dependent translation initiation factor
• Alternate names: CBP80/20-dependent translation initiation factor,
• Gene location: 18q21.1 (48539030: 48863216)     Exons: 17     NC_000018.10
• Gene summary(Entrez): CTIF is a component of the CBP80 (NCBP1; MIM 600469)/CBP20 (NCBP2; MIM 605133) translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step
• OMIM: 613178

Protein Summary

• Protein general information: O43310  
  • Name: CBP80/20 dependent translation initiation factor
  • Length: 598  
  • Mass: 67587
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MENSSAASASSEAGSSRSQEIEELERFIDSYVLEYQVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSF
  SRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKL
  EDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFRRRRNDRRRQQRPPGGNKPQQHGDHQPGSAKHNRDHQK
  SYQGGSAPHPSGRPTHHGYSQNRRWHHGNMKHPPGDKGEAGAHRNAKETMTIENPKLEDTAGDTGHSSLEAPRSP
  DTLAPVASERLPPQQSGGPEVETKRKDSILPERIGERPKITLLQSSKDRLRRRLKEKDEVAVETTTPQQNKMDKL
  IEILNSMRNNSSDVDTKLTTFMEEAQNSTNSEEMLGEIVRTIYQKAVSDRSFAFTAAKLCDKMALFMVEGTKFRS
  LLLNMLQKDFTVREELQQQDVERWLGFITFLCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCS
  MELQSTGRLLEEQLPEMMTELLASARDKMLCPSESMLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA

• Structural information:
  • Protein Domains: (376..57-)
    (/note="MIF4G"-)
  • Interpro: IPR016024  IPR016021  IPR003890  
  • STRING: ENSP00000372459
• Other Databases: GeneCards:  CTIF  Malacards:  CTIF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0006446	regulation of translational initiation	IBA	biological process
GO:0008494	translation activator activity	IBA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0006446	regulation of translational initiation	IMP	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045727	positive regulation of translation	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq