• Gene id: 9805

Gene Summary

• Gene Symbol: SCRN1   Gene   UCSC   Ensembl
• Aliases: SES1
• Gene name: secernin 1
• Alternate names: secernin-1,
• Gene location: 7p14.3 (29990288: 29920102)     Exons: 11     NC_000007.14
• Gene summary(Entrez): This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
• OMIM: 142370

Protein Summary

• Protein general information: Q12765  
  • Name: Secernin 1
  • Length: 414  
  • Mass: 46382
• Sequence:

  MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMISRPAW
  LWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQGGNYFEDANSC
  HSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQSQGWWTGEGEFNFSEV
  FSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVSVLPQNRSSPCIHYFTGTPDP
  SRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKAHEWARAIIESDQEQGRKLRSTMLEL
  EKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK

• Structural information:
  • Interpro: IPR005322  
  • STRING: ENSP00000388942
• Other Databases: GeneCards:  SCRN1  Malacards:  SCRN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0006887	exocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0006887	exocytosis	ISS	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq