• Gene id: 9762

Gene Summary

• Gene Symbol: LZTS3   Gene   UCSC   Ensembl
• Aliases: PROSAPIP1
• Gene name: leucine zipper tumor suppressor family member 3
• Alternate names: leucine zipper putative tumor suppressor 3, ProSAP/Shank-interacting protein 1, leucine zipper, putative tumor suppressor family member 3, proline rich synapse associated protein interacting protein 1,
• Gene location: 20p13 (3173596: 3162616)     Exons: 6     NC_000020.11
• OMIM: 601211

Protein Summary

• Protein general information: O60299  
  • Name: Leucine zipper putative tumor suppressor 3 (ProSAP interacting protein 1) (ProSAPiP1)
  • Length: 673  
  • Mass: 71791
• Sequence:

  MAKLETLPVRADPGRDPLLAFAPRPSELGPPDPRLAMGSVGSGVAHAQEFAMKSVGTRTGGGGSQGSFPGPRGSG
  SGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPSHPPKLLATSGK
  LDQCSEPLVRPSAFKPVVPKNFHSMQNLCPPQTNGTPEGRQGPGGLKGGLDKSRTMTPAGGSGSGLSDSGRNSLT
  SLPTYSSSYSQHLAPLSASTSHINRIGTASYGSGSGGSSGGGSGYQDLGTSDSGRASSKSGSSSSMGRPGHLGSG
  EGGGGGLPFAACSPPSPSALIQELEERLWEKEQEVAALRRSLEQSEAAVAQVLEERQKAWERELAELRQGCSGKL
  QQVARRAQRAQQGLQLQVLRLQQDKKQLQEEAARLMRQREELEDKVAACQKEQADFLPRIEETKWEVCQKAGEIS
  LLKQQLKDSQADVSQKLSEIVGLRSQLREGRASLREKEEQLLSLRDSFSSKQASLELGEGELPAACLKPALTPVD
  PAEPQDALATCESDEAKMRRQAGVAAAASLVSVDGEAEAGGESGTRALRREVGRLQAELAAERRARERQGASFAE
  ERRVWLEEKEKVIEYQKQLQLSYVEMYQRNQQLERRLRERGAAGGASTPTPQHGEEKKAWTPSRLERIESTEI

• Structural information:
  • Interpro: IPR033295  
  • STRING: ENSP00000353496
• Other Databases: GeneCards:  LZTS3  Malacards:  LZTS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043197	dendritic spine	IBA	cellular component
GO:0061001	regulation of dendritic spine morphogenesis	IBA	biological process
GO:0045202	synapse	ISS	cellular component
GO:0061001	regulation of dendritic spine morphogenesis	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq