• Gene id: 9761

Gene Summary

• Gene Symbol: MLEC   Gene   UCSC   Ensembl
• Aliases: KIAA0152
• Gene name: malectin
• Alternate names: malectin, oligosaccharyltransferase complex subunit (non-catalytic),
• Gene location: 12q24.31 (102120130: 102073102)     Exons: 11     NC_000012.12
• Gene summary(Entrez): This gene encodes the carbohydrate-binding protein malectin which is a Type I membrane-anchored endoplasmic reticulum protein. This protein has an affinity for Glc2Man9GlcNAc2 (G2M9) N-glycans and is involved in regulating glycosylation in the endoplasmic
• OMIM: 613802

Protein Summary

• Protein general information: Q14165  
  • Name: Malectin
  • Length: 292  
  • Mass: 32234
• Sequence:

  MLGAWAVEGTAVALLRLLLLLLPPAIRGPGLGVAGVAGAAGAGLPESVIWAVNAGGEAHVDVHGIHFRKDPLEGR
  VGRASDYGMKLPILRSNPEDQILYQTERYNEETFGYEVPIKEEGDYVLVLKFAEVYFAQSQQKVFDVRLNGHVVV
  KDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEVSTFTGKLYIEFVKGYYDNPKVCALYIMAGTVDDVPKLQPHP
  GLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNPYASDNSSLMFPILVAFGVFIPTLFCLCRL

• Structural information:
  • Interpro: IPR021720  IPR039155  
  • PDB: 6S7T
  • PDBsum: 6S7T
  • STRING: ENSP00000228506
• Other Databases: GeneCards:  MLEC  Malacards:  MLEC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0030246	carbohydrate binding	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)