• Gene id: 9723

Gene Summary

• Gene Symbol: SEMA3E   Gene   UCSC   Ensembl
• Aliases: M-SEMAH, M-SemaK, SEMAH, coll-5
• Gene name: semaphorin 3E
• Alternate names: semaphorin-3E, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E,
• Gene location: 7q21.11 (83649138: 83363237)     Exons: 18     NC_000007.14
• Gene summary(Entrez): Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and st
• OMIM: 608166

Protein Summary

• Protein general information: O15041  
  • Name: Semaphorin 3E
  • Length: 775  
  • Mass: 89228
• Sequence:

  MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFHSPFGFLDLHTMLLDEYQERLFVGGR
  DLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVRVLHHYNRTHLLTCGTGAFDPVCAFIRVGYH
  LEDPLFHLESPRSERGRGRCPFDPSSSFISTLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEP
  KFVGSYMIPDNEDRDDNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMN
  GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHKEGPEYHWSVYEGKVP
  YPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHKKPILVKTDGKYNLKQIAVDRVEAEDGQYDV
  LFIGTDNGIVLKVITIYNQEMESMEEVILEELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSA
  CADCCLARDPYCAWDGISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
  ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEE
  EKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDRKRKKLKMSPSKWK
  YANPQEKKLRSKPEHYRLPRHTLDS

• Structural information:
  • Protein Domains: (32..51-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (581..66-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013151  IPR016201   IPR001627  IPR036352  IPR027231  IPR015513  IPR015943  
  • Prosite: PS50835 PS51004
  • STRING: ENSP00000303212
• Other Databases: GeneCards:  SEMA3E  Malacards:  SEMA3E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001755	neural crest cell migration	IBA	biological process
GO:0050808	synapse organization	ISS	biological process
GO:0016525	negative regulation of angiogenesis	ISS	biological process
GO:0008360	regulation of cell shape	ISS	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0001953	negative regulation of cell-matrix adhesion	ISS	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	ISS	biological process
GO:0071526	semaphorin-plexin signaling pathway	ISS	biological process
GO:0001569	branching involved in blood vessel morphogenesis	ISS	biological process
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:2000249	regulation of actin cytoskeleton reorganization	IEA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0001953	negative regulation of cell-matrix adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
CHARGE syndrome	KEGG:H00556
CHARGE syndrome	KEGG:H00556
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray