• Gene id: 9722

Gene Summary

• Gene Symbol: NOS1AP   Gene   UCSC   Ensembl
• Aliases: 6330408P19Rik, CAPON
• Gene name: nitric oxide synthase 1 adaptor protein
• Alternate names: carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON), C-terminal PDZ ligand of neuronal nitric oxide synthase protein, ligand of neuronal nitric oxide synthase with car,
• Gene location: 1q23.3 (13604619: 13083360)     Exons: 24     NC_000008.11
• Gene summary(Entrez): This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain
• OMIM: 605551

Protein Summary

• Protein general information: O75052  
  • Name: Carboxyl terminal PDZ ligand of neuronal nitric oxide synthase protein (C terminal PDZ ligand of neuronal nitric oxide synthase protein) (Nitric oxide synthase 1 adaptor protein)
  • Length: 506  
  • Mass: 56150
• Sequence:

  MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIM
  VSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKK
  KSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPL
  PGNDVLEFSRGVTDLDAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLL
  QQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELELKLSGQNAMGSQDSL
  LEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLGRRDCLVKLECFRFLPPEDTPPPAQGEALLG
  GLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNVLQRQELGDGLDDEIAV

• Structural information:
  • Protein Domains: (26..19-)
    (/note="PID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148"-)
  • Interpro: IPR011993  IPR006020  
  • Prosite: PS01179
  • STRING: ENSP00000355133
• Other Databases: GeneCards:  NOS1AP  Malacards:  NOS1AP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050998	nitric-oxide synthase binding	IBA	molecular function
GO:0050999	regulation of nitric-oxide synthase activity	NAS	biological process
GO:0045428	regulation of nitric oxide biosynthetic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0030315	T-tubule	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0050998	nitric-oxide synthase binding	IEA	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:1902514	regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	TAS	biological process
GO:1903762	positive regulation of voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	ISS	biological process
GO:0010750	positive regulation of nitric oxide mediated signal transduction	ISS	biological process
GO:0098901	regulation of cardiac muscle cell action potential	ISS	biological process
GO:1902514	regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0030315	T-tubule	ISS	colocalizes with
GO:0098901	regulation of cardiac muscle cell action potential	TAS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:1901381	positive regulation of potassium ion transmembrane transport	ISS	biological process
GO:0005901	caveola	ISS	colocalizes with
GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization	IMP	biological process
GO:0003062	regulation of heart rate by chemical signal	IMP	biological process
GO:2000170	positive regulation of peptidyl-cysteine S-nitrosylation	ISS	biological process
GO:0031965	nuclear membrane	ISS	colocalizes with
GO:0051000	positive regulation of nitric-oxide synthase activity	ISS	biological process
GO:1901841	regulation of high voltage-gated calcium channel activity	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0030018	Z disc	ISS	cellular component
GO:1901841	regulation of high voltage-gated calcium channel activity	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0045429	positive regulation of nitric oxide biosynthetic process	ISS	biological process
GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization	ISS	biological process
GO:1902261	positive regulation of delayed rectifier potassium channel activity	ISS	biological process
GO:0042383	sarcolemma	ISS	cellular component
GO:0033017	sarcoplasmic reticulum membrane	ISS	cellular component
GO:1902937	inward rectifier potassium channel complex	ISS	colocalizes with
GO:1990454	L-type voltage-gated calcium channel complex	ISS	colocalizes with
GO:0050998	nitric-oxide synthase binding	ISS	molecular function
GO:0098974	postsynaptic actin cytoskeleton organization	IMP	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IDA	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IDA	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IDA	biological process
GO:0098974	postsynaptic actin cytoskeleton organization	IDA	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04713	Circadian entrainment

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq