• Gene id: 9705

Gene Summary

• Gene Symbol: ST18   Gene   UCSC   Ensembl
• Aliases: NZF-3, NZF3, ZC2H2C3, ZC2HC10, ZNF387
• Gene name: ST18 C2H2C-type zinc finger transcription factor
• Alternate names: suppression of tumorigenicity 18 protein, ST18, C2H2C-type zinc finger, neural zinc finger transcription factor 3, suppression of tumorigenicity 18 (breast carcinoma) (zinc finger protein), suppression of tumorigenicity 18, zinc finger, zinc finger protein 387,
• Gene location: 8q11.23 (52409878: 52110831)     Exons: 36     NC_000008.11
• OMIM: 605424

Protein Summary

• Protein general information: O60284  
  • Name: Suppression of tumorigenicity 18 protein (Zinc finger protein 387)
  • Length: 1047  
  • Mass: 115155
  • Tissue specificity: Detected at low levels in heart, liver, kidney, skeletal muscle, pancreas, testis, ovary and prostate. Detected at even lower levels in mammary epithelial cells and breast cancer cells. {ECO
• Sequence:

  MDAEAEDKTLRTRSKGTEVPMDSLIQELSVAYDCSMAKKRTAEDQALGVPVNKRKSLLMKPRHYSPKADCQEDRS
  DRTEDDGPLETHGHSTAEEIMIKPMDESLLSTAQENSSRKEDRYSCYQELMVKSLMHLGKFEKNVSVQTVSENLN
  DSGIQSLKAESDEADECFLIHSDDGRDKIDDSQPPFCSSDDNESNSESAENGWDSGSNFSEETKPPRVPKYVLTD
  HKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQNALAEPLDGNAQPSFPDVEEEDSESLAVMTEEGSDLEKAK
  GNLSLLEQAIALQAERGCVFHNTYKELDRFLLEHLAGERRQTKVIDMGGRQIFNNKHSPRPEKRETKCPIPGCDG
  TGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEKLAMSQDK
  NQLDSPQTGQCPDQAHRTSLVKQIEFNFPSQAITSPRATVSKEQEKFGKVPFDYASFDAQVFGKRPLIQTVQGRK
  TPPFPESKHFPNPVKFPNRLPSAGAHTQSPGRASSYSYGQCSEDTHIAAAAAILNLSTRCREATDILSNKPQSLH
  AKGAEIEVDENGTLDLSMKKNRILDKSAPLTSSNTSIPTPSSSPFKTSSILVNAAFYQALCDQEGWDTPINYSKT
  HGKTEEEKEKDPVSSLENLEEKKFPGEASIPSPKPKLHARDLKKELITCPTPGCDGSGHVTGNYASHRSVSGCPL
  ADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQG
  HISGKYTSHRTASGCPLAAKRQKENPLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVI
  KKGKVSEELMTIKLKATGGIESDEEIRHLDEEIKELNESNLKIEADMMKLQTQITSMESNLKTIEEENKLIEQNN
  ESLLKELAGLSQALISSLADIQLPQMGPISEQNFEAYVNTLTDMYSNLERDYSPECKALLESIKQAVKGIHV

• Structural information:
  • Interpro: IPR013681  IPR002515  IPR036060  
  • Prosite: PS51802
  • PDB: 2CS8
  • PDBsum: 2CS8
  • STRING: ENSP00000276480
• Other Databases: GeneCards:  ST18  Malacards:  ST18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IMP	biological process
GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray