• Gene id: 9683

Gene Summary

• Gene Symbol: N4BP1   Gene   UCSC   Ensembl
• Gene name: NEDD4 binding protein 1
• Alternate names: NEDD4-binding protein 1,
• Gene location: 16q12.1 (48610213: 48538725)     Exons: 7     NC_000016.10
• OMIM: 613584

Protein Summary

• Protein general information: O75113  
  • Name: NEDD4 binding protein 1 (N4BP1)
  • Length: 896  
  • Mass: 100379
  • Tissue specificity: Detected in heart, lung, brain, liver, skeletal muscle, pancreas, kidney, spleen, testis and ovary. {ECO
• Sequence:

  MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKEYIKGICEP
  ELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSS
  QKESEVKREFKQFVEAHADNYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNI
  SRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQFS
  LENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMGYSQEIVEKVIKVYGPST
  EPLLLLEEIEKENKRFQEDREFSAGTVYPETNKTKNKGVYSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFKVE
  AKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENG
  LHQQPEPLLPNNMKSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTL
  KIPYKLELKNEPGRTDLKHIVIDGSNVAITHGLKKFFSCRGIAIAVEYFWKLGNRNITVFVPQWRTRRDPNVTEQ
  HFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVG
  DIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLP
  QQPHFPLLPALPSLQQNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNALSAMVLD

• Structural information:
  • Interpro: IPR021869  
  • PDB: 6Q3V
  • PDBsum: 6Q3V
  • DIP: 41205
  • STRING: ENSP00000262384
• Other Databases: GeneCards:  N4BP1  Malacards:  N4BP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031397	negative regulation of protein ubiquitination	IBA	biological process
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016605	PML body	IBA	cellular component
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0031397	negative regulation of protein ubiquitination	ISS	biological process
GO:0005730	nucleolus	ISS	cellular component
GO:0016605	PML body	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0034644	cellular response to UV	IEA	biological process
GO:0016605	PML body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0034644	cellular response to UV	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq