• Gene id: 9653

Gene Summary

• Gene Symbol: HS2ST1   Gene   UCSC   Ensembl
• Aliases: dJ604K5.2
• Gene name: heparan sulfate 2-O-sulfotransferase 1
• Alternate names: heparan sulfate 2-O-sulfotransferase 1, 2-O-sulfotransferase, 2OST,
• Gene location: 1p22.3 (86914634: 87109981)     Exons: 7     NC_000001.11
• Gene summary(Entrez): Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that trans
• OMIM: 609237

Protein Summary

• Protein general information: Q7LGA3  
  • Name: Heparan sulfate 2 O sulfotransferase 1 (2 O sulfotransferase) (2OST) (EC 2.8.2. )
  • Length: 356  
  • Mass: 41881
• Sequence:

  MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMV
  IIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAK
  FGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHS
  SECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQT
  IAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEKIYPKSN

• Structural information:
  • Interpro: IPR007734  IPR027417  IPR005331  
  • STRING: ENSP00000359581
• Other Databases: GeneCards:  HS2ST1  Malacards:  HS2ST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IBA	biological process
GO:0004394	heparan sulfate 2-O-sulfotransferase activity	IBA	molecular function
GO:0015015	heparan sulfate proteoglycan biosynthetic process, enzymatic modification	IBA	biological process
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004394	heparan sulfate 2-O-sulfotransferase activity	TAS	molecular function
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq