• Gene id: 9637

Gene Summary

• Gene Symbol: FEZ2   Gene   UCSC   Ensembl
• Aliases: HUM3CL
• Gene name: fasciculation and elongation protein zeta 2
• Alternate names: fasciculation and elongation protein zeta-2, pre-T/NK cell associated protein (3Cl), zygin 2, zygin II,
• Gene location: 2p22.2 (36598189: 36552238)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Other orthologs include the rat gene that encodes zygin II, which can bind to synaptotagmin. [provided by RefSeq, Jul
• OMIM: 604826

Protein Summary

• Protein general information: Q9UHY8  
  • Name: Fasciculation and elongation protein zeta 2 (Zygin II) (Zygin 2)
  • Length: 353  
  • Mass: 39666
  • Tissue specificity: Expressed in nonneural tissues, such as heart, lung, spleen, muscle, testis, placenta and melanocytes.
• Sequence:

  MAADGDWQDFYEFQEPARSLLDQENCNASPEPGAEAGAEAGGGADGFPAPACSLEEKLSLCFRPSDPGAEPPRTA
  VRPITERSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEKGVSDSLLFDTSDDEELREQLDMHSII
  VSCVNDEPLFTADQVIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSTGSYEERVKRLSVSELNEIL
  EEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPG
  TYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYILKVLCPT

• Structural information:
  • Interpro: IPR011680  IPR015641  
  • STRING: ENSP00000368547
• Other Databases: GeneCards:  FEZ2  Malacards:  FEZ2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902902	negative regulation of autophagosome assembly	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)