• Gene id: 9595

Gene Summary

• Gene Symbol: CYTIP   Gene   UCSC   Ensembl
• Aliases: B3-1, CASP, CYBR, CYTHIP, HE, PSCDBP
• Gene name: cytohesin 1 interacting protein
• Alternate names: cytohesin-interacting protein, cbp HE, cytohesin binder and regulator, cytohesin binding protein HE, cytohesin-associated scaffolding protein, pleckstrin homology Sec7 and coiled-coil domains-binding protein,
• Gene location: 2q24.1 (157444088: 157412781)     Exons: 9     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene contains 2 leucine zipper domains and a putative C-terminal nuclear targeting signal, but does not have any hydrophobic regions. This protein is expressed weakly in resting NK and T cells. The encoded protein modulates the
• OMIM: 616918

Protein Summary

• Protein general information: O60759  
  • Name: Cytohesin interacting protein (Cytohesin binder and regulator) (CYBR) (Cytohesin associated scaffolding protein) (CASP) (Cytohesin binding protein HE) (Cbp HE) (Pleckstrin homology Sec7 and coiled coil domains binding protein)
  • Length: 359  
  • Mass: 40010
  • Tissue specificity: Expressed in lymph nodes, thymus, spleen, lung, peripheral blood leukocytes and bone marrow. {ECO
• Sequence:

  MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQR
  KLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDL
  IRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFG
  PLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDECFIPKEGDDFLRRSSSR
  RNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF

• Structural information:
  • Protein Domains: (77..16-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR001478  IPR036034  
  • Prosite: PS50106
  • PDB: 2Z17
  • PDBsum: 2Z17
  • STRING: ENSP00000264192
• Other Databases: GeneCards:  CYTIP  Malacards:  CYTIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030155	regulation of cell adhesion	IBA	biological process
GO:0005938	cell cortex	IBA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030155	regulation of cell adhesion	IBA	biological process
GO:0005938	cell cortex	IBA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881