• Gene id: 9585

Gene Summary

• Gene Symbol: KIF20B   Gene   UCSC   Ensembl
• Aliases: CT90, KRMP1, MPHOSPH1, MPP-1, MPP1
• Gene name: kinesin family member 20B
• Alternate names: kinesin-like protein KIF20B, M-phase phosphoprotein 1, cancer/testis antigen 90, kinesin-related motor interacting with PIN1, mitotic kinesin-like protein, mitotic kinesin-related protein,
• Gene location: 10q23.31 (89701589: 89774942)     Exons: 9     NC_000010.11
• OMIM: 605498

Protein Summary

• Protein general information: Q96Q89  
  • Name: Kinesin like protein KIF20B (Cancer/testis antigen 90) (CT90) (Kinesin family member 20B) (Kinesin related motor interacting with PIN1) (M phase phosphoprotein 1) (MPP1)
  • Length: 1820  
  • Mass: 210629
  • Tissue specificity: Brain, ovary, kidney and testis (at protein level) (PubMed
• Sequence:

  MESNFNQEGVPRPSYVFSADPIARPSEINFDGIKLDLSHEFSLVAPNTEANSFESKDYLQVCLRIRPFTQSEKEL
  ESEGCVHILDSQTVVLKEPQCILGRLSEKSSGQMAQKFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFT
  YGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIASKSALLRQIKE
  VTVHNDSDDTLYGSLTNSLNISEFEESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVSSKFQKRKML
  RLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKILQIEDSEMSRVIRVSE
  LSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLKNSEKSKFQQHVPFRESKLTHYFQSFFNGKGKI
  CMIVNISQCYLAYDETLNVLKFSAIAQKVCVPDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENS
  LEDLMEDEDLVEELENAEETQNVETKLLDEDLDKTLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFK
  IREEVTQEFTQYWAQREADFKETLLQEREILEENAERRLAIFKDLVGKCDTREEAAKDICATKVETEETHNYVGF
  EDIIDSLQDNVADIKKQAEIAHLYIASLPDPQEATACLELKFNQIKAELAKTKGELIKTKEELKKRENESDSLIQ
  ELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKSHMENTFKCNDKADTSSLIINNKLICNETVEVPKDSKS
  KICSERKRVNENELQQDEPPAKKGSIHVSSAITEDQKKSEEVRPNIAEIEDIRVLQENNEGLRAFLLTIENELKN
  EKEEKAELNKQIVHFQQELSLSEKKNLTLSKEVQQIQSNYDIAIAELHVQKSKNQEQEEKIMKLSNEIETATRSI
  TNNVSQIKLMHTKIDELRTLDSVSQISNIDLLNLRDLSNGSEEDNLPNTQLDLLGNDYLVSKQVKEYRIQEPNRE
  NSFHSSIEAIWEECKEIVKASSKKSHQIEELEQQIEKLQAEVKGYKDENNRLKEKEHKNQDDLLKEKETLIQQLK
  EELQEKNVTLDVQIQHVVEGKRALSELTQGVTCYKAKIKELETILETQKVECSHSAKLEQDILEKESIILKLERN
  LKEFQEHLQDSVKNTKDLNVKELKLKEEITQLTNNLQDMKHLLQLKEEEEETNRQETEKLKEELSASSARTQNLK
  ADLQRKEEDYADLKEKLTDAKKQIKQVQKEVSVMRDEDKLLRIKINELEKKKNQCSQELDMKQRTIQQLKEQLNN
  QKVEEAIQQYERACKDLNVKEKIIEDMRMTLEEQEQTQVEQDQVLEAKLEEVERLATELEKWKEKCNDLETKNNQ
  RSNKEHENNTDVLGKLTNLQDELQESEQKYNADRKKWLEEKMMLITQAKEAENIRNKEMKKYAEDRERFFKQQNE
  MEILTAQLTEKDSDLQKWREERDQLVAALEIQLKALISSNVQKDNEIEQLKRIISETSKIETQIMDIKPKRISSA
  DPDKLQTEPLSTSFEISRNKIEDGSVVLDSCEVSTENDQSTRFPKPELEIQFTPLQPNKMAVKHPGCTTPVTVKI
  PKARKRKSNEMEEDLVKCENKKNATPRTNLKFPISDDRNSSVKKEQKVAIRPSSKKTYSLRSQASIIGVNLATKK
  KEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQ
  KMKESDHQIIKRRLRTKTAK

• Structural information:
  • Protein Domains: (58..47-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR028828  IPR027640  IPR019821  IPR001752  IPR036961   IPR027417  
  • Prosite: PS00411 PS50067
  • DIP: 103
  • STRING: ENSP00000360793
• Other Databases: GeneCards:  KIF20B  Malacards:  KIF20B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005871	kinesin complex	IBA	cellular component
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005874	microtubule	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:1990023	mitotic spindle midzone	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0070938	contractile ring	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IDA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1903438	positive regulation of mitotic cytokinetic process	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:2000114	regulation of establishment of cell polarity	ISS	biological process
GO:0090316	positive regulation of intracellular protein transport	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0051233	spindle midzone	ISS	cellular component
GO:0030496	midbody	ISS	cellular component
GO:2001224	positive regulation of neuron migration	ISS	biological process
GO:0048812	neuron projection morphogenesis	ISS	biological process
GO:0035372	protein localization to microtubule	ISS	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007088	regulation of mitotic nuclear division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0090316	positive regulation of intracellular protein transport	IEA	biological process
GO:1903438	positive regulation of mitotic cytokinetic process	IEA	biological process
GO:2000114	regulation of establishment of cell polarity	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0035372	protein localization to microtubule	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0051233	spindle midzone	IEA	cellular component
GO:0070201	regulation of establishment of protein localization	IEA	biological process
GO:2001222	regulation of neuron migration	IEA	biological process
GO:2001224	positive regulation of neuron migration	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007050	cell cycle arrest	NAS	biological process
GO:0007088	regulation of mitotic nuclear division	NAS	biological process
GO:0050699	WW domain binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881