• Gene id: 9562

Gene Summary

• Gene Symbol: MINPP1   Gene   UCSC   Ensembl
• Aliases: HIPER1, MINPP2, MIPP
• Gene name: multiple inositol-polyphosphate phosphatase 1
• Alternate names: multiple inositol polyphosphate phosphatase 1, 2,3-BPG phosphatase, 2,3-bisphosphoglycerate 3-phosphatase, inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase, ins(1,3,4,5)P(4) 3-phosphatase, multiple inositol polyphosphate histidine phosphatase, 1, multiple ino,
• Gene location: 10q23.2 (87504465: 87553460)     Exons: 7     NC_000010.11
• Gene summary(Entrez): This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also conve
• OMIM: 605391

Protein Summary

• Protein general information: Q9UNW1  
  • Name: Multiple inositol polyphosphate phosphatase 1 (EC 3.1.3.62) (2,3 bisphosphoglycerate 3 phosphatase) (2,3 BPG phosphatase) (EC 3.1.3.80) (Inositol (1,3,4,5) tetrakisphosphate 3 phosphatase) (Ins(1,3,4,5)P(4) 3 phosphatase)
  • Length: 487  
  • Mass: 55051
  • Tissue specificity: Widely expressed with highest levels in kidney, liver and placenta. {ECO
• Sequence:

  MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLE
  GTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKG
  RQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKL
  MRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
  WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLL
  PLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQE
  TVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

• Structural information:
  • Interpro: IPR000560  IPR029033  IPR016274  
  • Prosite: PS00014
  • CDD: cd07061
  • STRING: ENSP00000361064
• Other Databases: GeneCards:  MINPP1  Malacards:  MINPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003993	acid phosphatase activity	IBA	molecular function
GO:0052745	inositol phosphate phosphatase activity	IBA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0101006	protein histidine phosphatase activity	TAS	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0006797	polyphosphate metabolic process	TAS	biological process
GO:0034417	bisphosphoglycerate 3-phosphatase activity	IEA	molecular function
GO:0052826	inositol hexakisphosphate 2-phosphatase activity	IEA	molecular function
GO:0004446	inositol-hexakisphosphate phosphatase activity	IEA	molecular function
GO:0030351	inositol-1,3,4,5,6-pentakisphosphate 3-phosphatase activity	TAS	molecular function
GO:0051717	inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity	TAS	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0052826	inositol hexakisphosphate 2-phosphatase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034417	bisphosphoglycerate 3-phosphatase activity	IDA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0030282	bone mineralization	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0052745	inositol phosphate phosphatase activity	NAS	molecular function
GO:0001503	ossification	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00562	Inositol phosphate metabolism
hsa00010	Glycolysis / Gluconeogenesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881