• Gene id: 9507

Gene Summary

• Gene Symbol: ADAMTS4   Gene   UCSC   Ensembl
• Aliases: ADAMTS-2, ADAMTS-4, ADMP-1
• Gene name: ADAM metallopeptidase with thrombospondin type 1 motif 4
• Alternate names: A disintegrin and metalloproteinase with thrombospondin motifs 4, ADAM-TS 4, ADAM-TS4, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4, aggrecanase-1, epididymis secretory sperm binding protein,
• Gene location: 1q23.3 (161202338: 161184301)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegr
• OMIM: 604041

Protein Summary

• Protein general information: O75173  
  • Name: A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAM TS 4) (ADAM TS4) (ADAMTS 4) (EC 3.4.24.82) (ADMP 1) (Aggrecanase 1)
  • Length: 837  
  • Mass: 90197
  • Tissue specificity: Expressed in brain, lung and heart (PubMed
• Sequence:

  MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEEIVFPEKLNGSVLPGS
  GAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL
  GVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVV
  ADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
  TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHELGHVFNMLHDNSK
  PCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQ
  LTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGP
  WGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
  PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHAGCDRIIGSKKKFDKC
  MVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTD
  VVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQIL
  EILRRRPWAGRK

• Structural information:
  • Protein Domains: (218..42-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (437..51-)
    (/note="Disintegrin-)
    (520..57-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210"-)
  • Interpro: IPR041645  IPR006586  IPR010294  IPR013273  IPR024079   IPR001590  IPR002870  IPR000884  IPR036383  
  • Prosite: PS50215 PS50092 PS00142
  • PDB: 2RJP 3B2Z 4WK7 4WKE 4WKI
  • PDBsum: 2RJP 3B2Z 4WK7 4WKE 4WKI
  • STRING: ENSP00000356975
• Other Databases: GeneCards:  ADAMTS4  Malacards:  ADAMTS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008233	peptidase activity	IDA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	TAS	molecular function
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Rheumatoid arthritis	PMID:11801682
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq