• Gene id: 9480

Gene Summary

• Gene Symbol: ONECUT2   Gene   UCSC   Ensembl
• Aliases: OC-2, OC2
• Gene name: one cut homeobox 2
• Alternate names: one cut domain family member 2, HNF-6-beta, ONECUT-2 homeodomain transcription factor, hepatocyte nuclear factor 6-beta, onecut 2, transcription factor ONECUT-2,
• Gene location: 18q21.31 (57435373: 57491297)     Exons: 26     NC_000018.10
• Gene summary(Entrez): This gene encodes a member of the onecut family of transcription factors, which are characterized by a cut domain and an atypical homeodomain. The protein binds to specific DNA sequences and stimulates expression of target genes, including genes involved
• OMIM: 604894

Protein Summary

• Protein general information: O95948  
  • Name: One cut domain family member 2 (Hepatocyte nuclear factor 6 beta) (HNF 6 beta) (One cut homeobox 2) (Transcription factor ONECUT 2) (OC 2)
  • Length: 504  
  • Mass: 54303
• Sequence:

  MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPAGGGSGGGGGGGGGGGGGGPGHEQELLASPSPHHAGRGAA
  GSLRGPPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGGDYRPELSIPLHHAMSMSCDSSPPGMGMSNTYTT
  LTPLQPLPPISTVSDKFHHPHPHHHPHHHHHHHHQRLSGNVSGSFTLMRDERGLPAMNNLYSPYKEMPGMSQSLS
  PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGH
  TQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQRVLCRSQGTLSDLLRNP
  KPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAIFKENKR
  PSKEMQITISQQLGLELTTVSNFFMNARRRSLEKWQDDLSTGGSSSTSSTCTKA

• Structural information:
  • Interpro: IPR003350  IPR009057  IPR001356  IPR010982  
  • Prosite: PS51042 PS50071
  • CDD: cd00086
  • STRING: ENSP00000419185
• Other Databases: GeneCards:  ONECUT2  Malacards:  ONECUT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0009653	anatomical structure morphogenesis	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0048935	peripheral nervous system neuron development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0031016	pancreas development	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0002064	epithelial cell development	IEA	biological process
GO:0001952	regulation of cell-matrix adhesion	IEA	biological process
GO:0001889	liver development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881