• Gene id: 94233

Gene Summary

• Gene Symbol: OPN4   Gene   UCSC   Ensembl
• Aliases: MOP
• Gene name: opsin 4
• Alternate names: melanopsin,
• Gene location: 10q23.2 (86653494: 86666459)     Exons: 11     NC_000010.11
• Gene summary(Entrez): Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. This gene encodes a photoreceptive opsin protein that is expressed within the ganglion and amacrine cell layers of the retina. In mouse, retinal ganglio
• OMIM: 603798

Protein Summary

• Protein general information: Q9UHM6  
  • Name: Melanopsin (Opsin 4)
  • Length: 478  
  • Mass: 52635
  • Tissue specificity: Eye. Expression is restricted within the ganglion and amacrine cell layers of the retina. {ECO
• Sequence:

  MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPLPTVDVPDHAHYTLGT
  VILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCG
  ALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDY
  MSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLL
  VILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVS
  RRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEA
  KAPPRPQGHEAETPGKTKGLIPSQDPRM

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001760  IPR027430  
  • Prosite: PS00237 PS50262 PS00238
  • STRING: ENSP00000361141
• Other Databases: GeneCards:  OPN4  Malacards:  OPN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071482	cellular response to light stimulus	IBA	biological process
GO:0008020	G protein-coupled photoreceptor activity	IBA	molecular function
GO:0007602	phototransduction	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007601	visual perception	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0009881	photoreceptor activity	IEA	molecular function
GO:0018298	protein-chromophore linkage	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007602	phototransduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007602	phototransduction	IEA	biological process
GO:0008020	G protein-coupled photoreceptor activity	IEA	molecular function
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0007602	phototransduction	IEA	biological process
GO:0008020	G protein-coupled photoreceptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0009584	detection of visible light	IEA	biological process
GO:0009584	detection of visible light	IEA	biological process
GO:0009584	detection of visible light	IEA	biological process
GO:0009584	detection of visible light	IEA	biological process
GO:0007602	phototransduction	IDA	biological process
GO:0005502	11-cis retinal binding	IDA	molecular function
GO:0008020	G protein-coupled photoreceptor activity	IDA	molecular function
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:1990384	hyaloid vascular plexus regression	ISS	biological process
GO:0007634	optokinetic behavior	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq