• Gene id: 94121

Gene Summary

• Gene Symbol: SYTL4   Gene   UCSC   Ensembl
• Aliases: SLP4
• Gene name: synaptotagmin like 4
• Alternate names: synaptotagmin-like protein 4, exophilin-2, granuphilin-a,
• Gene location: Xq22.1 (122144268: 122073543)     Exons: 25     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the synaptotagmin like protein family. Members of this family are characterized by an N-terminal Rab27 binding domain and C-terminal tandem C2 domains. The encoded protein binds specific small Rab GTPases and is involved in i
• OMIM: 300723

Protein Summary

• Protein general information: Q96C24  
  • Name: Synaptotagmin like protein 4 (Exophilin 2) (Granuphilin)
  • Length: 671  
  • Mass: 76024
• Sequence:

  MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGRLSP
  KTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSLRHKPAVSKRE
  TVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVPKLKSGKSALEAESESLDSFTADSDSTSRRDSLDKSGLFP
  EWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVVHESGSLGDRSKSVPGL
  NVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGDFGNIFVTGRIAFSLKYEQQTQSLVV
  HVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHG
  RFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEG
  GELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELT
  VWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL

• Structural information:
  • Protein Domains: (4..12-)
    (/note="RabBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00234-)
    (356..47-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (507..63-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR041282  IPR010911  IPR037303   IPR001565  IPR028694  IPR011011  IPR013083  
  • Prosite: PS50004 PS50916
  • CDD: cd04029
  • PDB: 2CSZ 3FDW 5X6T
  • PDBsum: 2CSZ 3FDW 5X6T
  • STRING: ENSP00000362080
• Other Databases: GeneCards:  SYTL4  Malacards:  SYTL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0006887	exocytosis	IBA	biological process
GO:0042043	neurexin family protein binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0001778	plasma membrane repair	IDA	biological process
GO:1905684	regulation of plasma membrane repair	IMP	biological process
GO:0032418	lysosome localization	IMP	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0005543	phospholipid binding	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0031092	platelet alpha granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0019898	extrinsic component of membrane	IEA	cellular component
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0006887	exocytosis	IEA	biological process
GO:0005543	phospholipid binding	IEA	molecular function
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0005543	phospholipid binding	ISS	molecular function
GO:0045921	positive regulation of exocytosis	IMP	biological process
GO:0042043	neurexin family protein binding	ISS	molecular function
GO:0071985	multivesicular body sorting pathway	IMP	biological process
GO:0019898	extrinsic component of membrane	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)