• Gene id: 9407

Gene Summary

• Gene Symbol: TMPRSS11D   Gene   UCSC   Ensembl
• Aliases: ASP, HAT
• Gene name: transmembrane serine protease 11D
• Alternate names: transmembrane protease serine 11D, adrenal secretory serine protease, airway trypsin-like protease, transmembrane protease, serine 11D,
• Gene location: 4q13.2 (67885062: 67820875)     Exons: 10     NC_000004.12
• Gene summary(Entrez): This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase,
• OMIM: 605369

Protein Summary

• Protein general information: O60235  
  • Name: Transmembrane protease serine 11D (EC 3.4.21. ) (Airway trypsin like protease) [Cleaved into: Transmembrane protease serine 11D non catalytic chain; Transmembrane protease serine 11D catalytic chain]
  • Length: 418  
  • Mass: 46263
  • Tissue specificity: Located in the cells of the submucosal serous glands of the bronchi and trachea.
• Sequence:

  MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFYRSSFQLLNVEYNSQLNSPATQEYRT
  LSGRIESLITKTFKESNLRNQFIRAHVAKLRQDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLE
  INPSTEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTA
  AHCFRSNSNPRDWIATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNI
  PPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSGMLCAGVPQGGVDACQGDSGGPLVQE
  DSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQQTGI

• Structural information:
  • Protein Domains: (46..16-)
    (/note="SEA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00188-)
    (187..41-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR017329  IPR009003  IPR001314  IPR000082  IPR036364   IPR001254  IPR018114  IPR033116  
  • Prosite: PS50024 PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000283916
• Other Databases: GeneCards:  TMPRSS11D  Malacards:  TMPRSS11D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IDA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008233	peptidase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007585	respiratory gaseous exchange by respiratory system	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)