• Gene id: 94030

Gene Summary

• Gene Symbol: LRRC4B   Gene   UCSC   Ensembl
• Aliases: HSM, LRIG4, NGL-3
• Gene name: leucine rich repeat containing 4B
• Alternate names: leucine-rich repeat-containing protein 4B, leucine-rich repeats and immunoglobulin-like domains 4, netrin-G3 ligand,
• Gene location: 19q13.33 (50568434: 50516891)     Exons: 6     NC_000019.10

Protein Summary

• Protein general information: Q9NT99  
  • Name: Leucine rich repeat containing protein 4B (Netrin G3 ligand) (NGL 3)
  • Length: 713  
  • Mass: 76434
• Sequence:

  MARARGSPCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVACSCSNQASRVICTRR
  DLAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVP
  TQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNL
  TALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
  HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNV
  TEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQDTGQYTCMVTNSAGNTTASAT
  LNVSAVDPVAAGGTGSGGGGPGGSGGVGGGSGGYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGG
  RPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLR
  KQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVASGGGVGGDSHLALPALERDHLNHHHYVAAAFKAHYS
  SNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI

• Structural information:
  • Protein Domains: (48..8-)
    (/note="LRRNT-)
    (311..36-)
    (/note="LRRCT-)
    (364..45-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  IPR026878  IPR000372  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000471502
• Other Databases: GeneCards:  LRRC4B  Malacards:  LRRC4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0044300	cerebellar mossy fiber	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq