• Gene id: 9389

Gene Summary

• Gene Symbol: SLC22A14   Gene   UCSC   Ensembl
• Aliases: OCTL2, OCTL4, ORCTL4
• Gene name: solute carrier family 22 member 14
• Alternate names: solute carrier family 22 member 14, ORCTL-4, organic cation transporter-like 4, organic cationic transporter-like 4, solute carrier family 22 (organic cation transporter), member 14,
• Gene location: 3p22.2 (38281661: 38318574)     Exons: 11     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 3. The encoded protein is a transmembrane protein which is thought to transport small m
• OMIM: 604048

Protein Summary

• Protein general information: Q9Y267  
  • Name: Solute carrier family 22 member 14 (Organic cation transporter like 4) (ORCTL 4)
  • Length: 594  
  • Mass: 66684
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAGEENFKEELRSQDASRNLNQHEVAGHPHSWSLEMLLRRLRAVHTKQDDKFANLLDAVGEFGTFQQRLVALTFI
  PSIMSAFFMFADHFVFTAQKPYCNTSWILAVGPHLSKAEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLN
  DTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAGLPIGSLIFRLITDKMGRYPAILLSLLGLIIFG
  FGTAFMNSFHLYLFFRFGISQSVVGYAISSISLATEWLVGEHRAHAIILGHCFFAVGAVLLTGIAYSLPHWQLLF
  LVGGILVIPFISYIWILPESPRWLMMKGKVKEAKQVLCYAASVNKKTIPSNLLDELQLPRKKVTRASVLDFCKNR
  QLCKVTLVMSCVWFTVSYTYFTLSLRMRELGVSVHFRHVVPSIMEVPARLCCIFLLQQIGRKWSLAVTLLQAIIW
  CLLLLFLPEGEDGLRLKWPRCPATELKSMTILVLMLREFSLAATVTVFFLYTAELLPTVLRATGLGLVSLASVAG
  AILSLTIISQTPSLLPIFLCCVLAIVAFSLSSLLPETRDQPLSESLNHSSQIRNKVKDMKTKETSSDDV

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000273173
• Other Databases: GeneCards:  SLC22A14  Malacards:  SLC22A14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Hyperparathyroidism	GAD: 20424473
Asthenozoospermia	MIK: 29726644
Plays a role in normal flagellar structure, motility and fertility	MIK: 27811987
Asthenozoospermia	MIK: 29726644
Male infertility	MIK: 29726644
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29726644	Idiopathic asthenozoospermia, Male infertility			100 (50 idiopathic asthenozoospermia patients, 50 normal sperm donors)	Male infertility
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R