• Gene id: 9358

Gene Summary

• Gene Symbol: ITGBL1   Gene   UCSC   Ensembl
• Aliases: OSCP, TIED
• Gene name: integrin subunit beta like 1
• Alternate names: integrin beta-like protein 1, integrin beta like 1, integrin, beta-like 1 (with EGF-like repeat domains), osteoblast-specific cysteine-rich protein, ten integrin EGF-like repeat domain-containing protein,
• Gene location: 13q33.1 (101452592: 101720855)     Exons: 13     NC_000013.11
• Gene summary(Entrez): This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 201
• OMIM: 604234

Protein Summary

• Protein general information: O95965  
  • Name: Integrin beta like protein 1 (Osteoblast specific cysteine rich protein) (Ten integrin EGF like repeat domain containing protein)
  • Length: 494  
  • Mass: 53921
  • Tissue specificity: Widely expressed in many tissues, but readily detectable only in aorta. {ECO
• Sequence:

  MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCI
  CHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDII
  CSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPW
  ESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
  CKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVV
  CGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDC
  DDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

• Structural information:
  • Interpro: IPR000742  IPR013111  IPR027070  IPR015812  
  • Prosite: PS00022 PS01186 PS00243
  • STRING: ENSP00000365351
• Other Databases: GeneCards:  ITGBL1  Malacards:  ITGBL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033627	cell adhesion mediated by integrin	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005178	integrin binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881