• Gene id: 9348

Gene Summary

• Gene Symbol: NDST3   Gene   UCSC   Ensembl
• Aliases: HSST3
• Gene name: N-deacetylase and N-sulfotransferase 3
• Alternate names: bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, GlcNAc N-deacetylase/ N-sulfotransferase 3, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3, N-deacetylase/N-sulfotransferase 3, N-heparan sulfate sulfotransferase 3, glucosaminyl N-dea,
• Gene location: 4q26 (118033321: 118258944)     Exons: 19     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacet
• OMIM: 610466

Protein Summary

• Protein general information: O95803  
  • Name: Bifunctional heparan sulfate N deacetylase/N sulfotransferase 3 (EC 2.8.2.8) (Glucosaminyl N deacetylase/N sulfotransferase 3) (NDST 3) (hNDST 3) (N heparan sulfate sulfotransferase 3) (N HSST 3) [Includes: Heparan sulfate N deacetylase 3 (EC 3. . . ); He
  • Length: 873  
  • Mass: 100902
  • Tissue specificity: Expressed in brain, kidney, liver, fetal and adult lung, adult pancreas, placenta, fetal spleen and fetal thymus. Not detected in adult/ fetal heart and skeletal muscle. {ECO
• Sequence:

  MSFIMKLHRHFQRTVILLATFCMVSIIISAYYLYSGYKQENELSETASEVDCGDLQHLPYQLMEVKAMKLFDASR
  TDPTVLVFVESQYSSLGQDIIMILESSRFQYHIEIAPGKGDLPVLIDKMKGKYILIIYENILKYINMDSWNRSLL
  DKYCVEYGVGVIGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQI
  NHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHDGIQRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLS
  LDRYILVDIDDIFVGKEGTRMNTNDVKALLDTQNLLRAQITNFTFNLGFSGKFYHTGTEEEDEGDDCLLGSVDEF
  WWFPHMWSHMQPHLFHNESSLVEQMILNKKFALEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKKVWNIKITSTE
  EYPHLKPARYRRGFIHKNIMVLPRQTCGLFTHTIFYKEYPGGPKELDKSIQGGELFFTVVLNPISIFMTHLSNYG
  NDRLGLYTFVNLANFVKSWTNLRLQTLPPVQLAHKYFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLV
  IGPQKTGTTALYLFLVMHPSILSNSPSPKTFEEVQFFNRNNYHRGIDWYMDFFPVPSNVTTDFLFEKSANYFHSE
  EAPKRAASLVPKAKIITILIDPSDRAYSWYQHQRSHEDPAALKFSFYEVISAGPRAPSELRALQKRCLVPGWYAS
  HIERWLVYFPPFQLLIIDGQQLRTDPATVMDEVQKFLGVLPHYNYSEALTFDSHKGFWCQLLEEGKTKCLGKSKG
  RKYPPMDSDSRTFLSSYYRDHNVELSKLLHKLGQPLPSWLRQELQKVR

• Structural information:
  • Interpro: IPR021930  IPR037359  IPR027417  IPR000863  
  • STRING: ENSP00000296499
• Other Databases: GeneCards:  NDST3  Malacards:  NDST3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IBA	biological process
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IBA	molecular function
GO:0019213	deacetylase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IEA	biological process
GO:0030210	heparin biosynthetic process	IEA	biological process
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IDA	molecular function
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IDA	biological process
GO:0102140	heparan sulfate N-deacetylase activity	IDA	molecular function
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IDA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IBA	biological process
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IBA	molecular function
GO:0019213	deacetylase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IEA	biological process
GO:0030210	heparin biosynthetic process	IEA	biological process
GO:0015016	[heparan sulfate]-glucosamine N-sulfotransferase activity	IDA	molecular function
GO:0015014	heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process	IDA	biological process
GO:0102140	heparan sulfate N-deacetylase activity	IDA	molecular function
GO:0015012	heparan sulfate proteoglycan biosynthetic process	IDA	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R