• Gene id: 933

Gene Summary

• Gene Symbol: CD22   Gene   UCSC   Ensembl
• Aliases: SIGLEC-2, SIGLEC2
• Gene name: CD22 molecule
• Alternate names: B-cell receptor CD22, B-lymphocyte cell adhesion molecule, BL-CAM, CD22 antigen, T-cell surface antigen Leu-14, sialic acid-binding Ig-like lectin 2,
• Gene location: 19q13.12 (35329168: 35347360)     Exons: 14     NC_000019.10
• OMIM: 300156

Protein Summary

• Protein general information: P20273  
  • Name: B cell receptor CD22 (B lymphocyte cell adhesion molecule) (BL CAM) (Sialic acid binding Ig like lectin 2) (Siglec 2) (T cell surface antigen Leu 14) (CD antigen CD22)
  • Length: 847  
  • Mass: 95348
  • Tissue specificity: B-lymphocytes.
• Sequence:

  MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTR
  LYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPE
  IQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDAD
  GKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
  KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQG
  RTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPS
  VTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSV
  SLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
  SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTL
  TVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLG
  CYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSEL
  IQFGVGERPQAQENVDYVILKH

• Structural information:
  • Protein Domains: (20..13-)
    (/note="Ig-like-V-type)
    (143..23-)
    1 (/note="Ig-like-C2-type)
    (242..32-)
    2 (/note="Ig-like-C2-type)
    (331..41-)
    3 (/note="Ig-like-C2-type)
    (419..50-)
    4 (/note="Ig-like-C2-type)
    (505..58-)
    (/note="Ig-like-C)
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  
  • Prosite: PS50835
  • PDB: 5VKJ 5VKM 5VL3
  • PDBsum: 5VKJ 5VKM 5VL3
  • STRING: ENSP00000085219
• Other Databases: GeneCards:  CD22  Malacards:  CD22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005769	early endosome	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0001791	IgM binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0033691	sialic acid binding	ISS	molecular function
GO:0033691	sialic acid binding	TAS	molecular function
GO:0042609	CD4 receptor binding	ISS	molecular function
GO:0042113	B cell activation	IDA	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	IDA	biological process
GO:0019903	protein phosphatase binding	ISS	molecular function
GO:0019903	protein phosphatase binding	TAS	molecular function
GO:0030100	regulation of endocytosis	IDA	biological process
GO:0050776	regulation of immune response	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0030888	regulation of B cell proliferation	ISS	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	IMP	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	TAS	biological process
GO:0051025	negative regulation of immunoglobulin secretion	ISS	biological process
GO:0050849	negative regulation of calcium-mediated signaling	ISS	biological process
GO:0030888	regulation of B cell proliferation	IBA	biological process
GO:0033691	sialic acid binding	IBA	molecular function
GO:0042609	CD4 receptor binding	IBA	molecular function
GO:0055037	recycling endosome	IBA	cellular component
GO:0005769	early endosome	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0019903	protein phosphatase binding	IBA	molecular function
GO:0042113	B cell activation	IBA	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	IBA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04662	B cell receptor signaling pathway
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq