• Gene id: 9325

Gene Summary

• Gene Symbol: TRIP4   Gene   UCSC   Ensembl
• Aliases: ASC-1, ASC1, HsT17391, MDCDC, SMABF1, ZC2HC5
• Gene name: thyroid hormone receptor interactor 4
• Alternate names: activating signal cointegrator 1, TR-interacting protein 4, TRIP-4, thyroid receptor-interacting protein 4, zinc finger, C2HC5-type,
• Gene location: 15q22.31 (64387835: 64455302)     Exons: 13     NC_000015.10
• Gene summary(Entrez): This gene encodes a subunit of the tetrameric nuclear activating signal cointegrator 1 (ASC-1) complex, which associates with transcriptional coactivators, nuclear receptors and basal transcription factors to facilitate nuclear receptors-mediated transcri
• OMIM: 604501

Protein Summary

• Protein general information: Q15650  
  • Name: Activating signal cointegrator 1 (ASC 1) (Thyroid receptor interacting protein 4) (TR interacting protein 4) (TRIP 4)
  • Length: 581  
  • Mass: 66146
• Sequence:

  MAVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEGKKGQFIEELITKWQKND
  QELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENSNSVKKKTKFV
  NLYTREGQDRLAVLLPGRHPCDCLGQKHKLINNCLICGRIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQK
  LLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSK
  LERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEP
  LGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRG
  IKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQ
  FPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV

• Structural information:
  • Interpro: IPR007374  IPR015947  IPR039128  IPR009349  
  • PDB: 2E5O
  • PDBsum: 2E5O
  • STRING: ENSP00000261884
• Other Databases: GeneCards:  TRIP4  Malacards:  TRIP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0030520	intracellular estrogen receptor signaling pathway	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0099053	activating signal cointegrator 1 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044389	ubiquitin-like protein ligase binding	IPI	molecular function
GO:0031594	neuromuscular junction	IMP	cellular component
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0045661	regulation of myoblast differentiation	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:0045661	regulation of myoblast differentiation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016922	nuclear receptor binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005813	centrosome	IDA	colocalizes with
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Congenital muscular dystrophies	KEGG:H00590
Spinal muscular atrophy with congenital bone fractures	KEGG:H02238
Congenital muscular dystrophies	KEGG:H00590
Spinal muscular atrophy with congenital bone fractures	KEGG:H02238
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)