• Gene id: 9311

Gene Summary

• Gene Symbol: ASIC3   Gene   UCSC   Ensembl
• Aliases: ACCN3, DRASIC, SLNAC1, TNaC1
• Gene name: acid sensing ion channel subunit 3
• Alternate names: acid-sensing ion channel 3, acid sensing (proton gated) ion channel 3, amiloride-sensitive cation channel 3, testis, modulatory subunit of ASIC2a, neuronal amiloride-sensitive cation channel 3, proton-gated cation channel subunit, testis sodium channel 1,
• Gene location: 7q36.1 (151048291: 151052755)     Exons: 11     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large
• OMIM: 617492

Protein Summary

• Protein general information: Q9UHC3  
  • Name: Acid sensing ion channel 3 (ASIC3) (hASIC3) (Amiloride sensitive cation channel 3) (Neuronal amiloride sensitive cation channel 3) (Testis sodium channel 1) (hTNaC1)
  • Length: 531  
  • Mass: 58905
  • Tissue specificity: Expressed by sensory neurons. Strongly expressed in brain, spinal chord, lung, lymph nodes, kidney, pituitary, heart and testis. {ECO
• Sequence:

  MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQVAERVRYYREFHHQTA
  LDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLY
  ARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVW
  RDNEETPFEVGIRVQIHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWGDCSSASLNPNYEPEPSDPLG
  SPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNCAHPAIDAMLRKDSCACPNPCASTRY
  AKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASL
  LTILEILDYLCEVFRDKVLGYFWNRQHSQRHSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTC
  YLVTQL

• Structural information:
  • Interpro: IPR001873  IPR004724  IPR020903  
  • Prosite: PS01206
  • STRING: ENSP00000297512
• Other Databases: GeneCards:  ASIC3  Malacards:  ASIC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005272	sodium channel activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0015280	ligand-gated sodium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005272	sodium channel activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005261	cation channel activity	TAS	molecular function
GO:0005272	sodium channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007600	sensory perception	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	IEA	biological process
GO:0050961	detection of temperature stimulus involved in sensory perception	IEA	biological process
GO:0042931	enterobactin transmembrane transporter activity	IEA	molecular function
GO:0010447	response to acidic pH	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0006812	cation transport	IEA	biological process
GO:0005261	cation channel activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0015280	ligand-gated sodium channel activity	IEA	molecular function
GO:0010447	response to acidic pH	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0050974	detection of mechanical stimulus involved in sensory perception	IEA	biological process
GO:0050968	detection of chemical stimulus involved in sensory perception of pain	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0050907	detection of chemical stimulus involved in sensory perception	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042930	enterobactin transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0050915	sensory perception of sour taste	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04750	Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq