Male Infertility Database

Search Result

Gene id

93081

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

TEX30 Gene UCSC Ensembl

Aliases

C13orf27

Gene name

testis expressed 30

Alternate names

testis-expressed protein 30, testis-expressed sequence 30 protein,

Gene location

13q33.1 (102773791: 102765887) Exons: 8 NC_000013.11

OMIM

603759

Protein Summary

Protein general information

Q5JUR7

Name: Testis expressed protein 30

Length: 227 Mass: 25585

Sequence

MSHTEVKLKIPFGNKLLDAVCLVPNKSLTYGIILTHGASGDMNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRI
KAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFR
LKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKK
CH

Structural information

Interpro:	IPR029058 IPR002925 IPR026555
STRING:	ENSP00000365200

Other Databases

GeneCards: TEX30 Malacards: TEX30

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28361989	Hyposperma togenesis	6 (3 controls, 3 Klienfelter s yndrome	Male infertility	Microarray	Show abstract
31037746	Spermatoge nic defect s	28 men with az oospermia	Male infertility	Microarray	Show abstract
31037746	Spermatoge nic defect s	16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All