Search Result
| Gene id | 9308 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CD83 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | BL11, HB15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | CD83 molecule | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | CD83 antigen, B-cell activation protein, CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), cell surface protein HB15, cell-surface glycoprotein, hCD83, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
6p23 (14117255: 14136917) Exons: 6 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 604534 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q01151 Name: CD83 antigen (hCD83) (B cell activation protein) (Cell surface protein HB15) (CD antigen CD83) Length: 205 Mass: 23042 Tissue specificity: Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQ KGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLA LVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CD83  Malacards: CD83 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||