• Gene id: 9294

Gene Summary

• Gene Symbol: S1PR2   Gene   UCSC   Ensembl
• Aliases: AGR16, DFNB68, EDG-5, EDG5, Gpcr13, H218, LPB2, S1P2
• Gene name: sphingosine-1-phosphate receptor 2
• Alternate names: sphingosine 1-phosphate receptor 2, CTD-2369P2.2, S1P receptor 2, S1P receptor EDG5, S1P receptor Edg-5, deafness, autosomal recessive 68, endothelial differentiation G-protein coupled receptor 5, endothelial differentiation, sphingolipid G-protein-coupled recep,
• Gene location: 19p13.2 (10231330: 10221432)     Exons: 2     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. The encoded protein is a receptor for sphingosine 1-phosphate, which participates in cell proliferation, survival, and transcriptional activation. Defect
• OMIM: 605111

Protein Summary

• Protein general information: O95136  
  • Name: Sphingosine 1 phosphate receptor 2 (S1P receptor 2) (S1P2) (Endothelial differentiation G protein coupled receptor 5) (Sphingosine 1 phosphate receptor Edg 5) (S1P receptor Edg 5)
  • Length: 353  
  • Mass: 38867
• Sequence:

  MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNL
  AASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLL
  LIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAA
  PQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
  RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV

• Structural information:
  • Interpro: IPR004063  IPR000276  IPR017452  IPR004061  
  • Prosite: PS00237 PS50262
  • PDB: 1ZTI
  • PDBsum: 1ZTI
  • DIP: 60682
  • STRING: ENSP00000466933
• Other Databases: GeneCards:  S1PR2  Malacards:  S1PR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0038036	sphingosine-1-phosphate receptor activity	IBA	molecular function
GO:0038036	sphingosine-1-phosphate receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008289	lipid binding	TAS	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0090394	negative regulation of excitatory postsynaptic potential	IEA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1903142	positive regulation of establishment of endothelial barrier	IMP	biological process
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0038036	sphingosine-1-phosphate receptor activity	IMP	molecular function
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IMP	biological process
GO:0046847	filopodium assembly	IMP	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IMP	biological process
GO:0031532	actin cytoskeleton reorganization	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04071	Sphingolipid signaling pathway

Diseases

Associated diseases	References
Deafness, autosomal recessive	KEGG:H00605
Deafness, autosomal recessive	KEGG:H00605
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R