• Gene id: 9275

Gene Summary

• Gene Symbol: BCL7B   Gene   UCSC   Ensembl
• Gene name: BAF chromatin remodeling complex subunit BCL7B
• Alternate names: B-cell CLL/lymphoma 7 protein family member B, B-cell CLL/lymphoma 7B, BCL tumor suppressor 7B, BCL7B, BAF complex component,
• Gene location: 7q11.23 (73557689: 73536355)     Exons: 8     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene kn
• OMIM: 610296

Protein Summary

• Protein general information: Q9BQE9  
  • Name: B cell CLL/lymphoma 7 protein family member B (allergen Hom s 3)
  • Length: 202  
  • Mass: 22195
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPS
  DASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLP
  SSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES

• Structural information:
  • Interpro: IPR006804  
  • STRING: ENSP00000411073
• Other Databases: GeneCards:  BCL7B  Malacards:  BCL7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030154	cell differentiation	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	NAS	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Williams-Beuren syndrome	KEGG:H01439
Williams-Beuren syndrome	KEGG:H01439
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq