Search Result
| Gene id | 9274 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | BCL7C Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Gene name | BAF chromatin remodeling complex subunit BCL7C | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | B-cell CLL/lymphoma 7 protein family member C, B-cell CLL/lymphoma 7C, BCL tumor suppressor 7C, BCL7C, BAF complex component, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
16p11.2 (31959042: 31952086) Exons: 11 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of t |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 605847 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8WUZ0 Name: B cell CLL/lymphoma 7 protein family member C Length: 217 Mass: 23468 Tissue specificity: Ubiquitous. {ECO | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERR GRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPG GITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: BCL7C  Malacards: BCL7C | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||