|
Gene id |
92597 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
MOB1B Gene UCSC Ensembl |
|
Aliases |
MATS2, MOB4A, MOBKL1A |
|
Gene name |
MOB kinase activator 1B |
|
Alternate names |
MOB kinase activator 1B, MOB1 Mps One Binder homolog B, MOB1, Mps One Binder kinase activator-like 1A, mob1 homolog 1A, mob1A, mps one binder kinase activator-like 1A, |
|
Gene location |
4q13.3 (70901969: 70988173) Exons: 10 NC_000004.12
|
|
Gene summary(Entrez) |
The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been
|
|
OMIM |
609282 |
Protein Summary
|
| Protein general information
| Q7L9L4
Name: MOB kinase activator 1B (Mob1 homolog 1A) (Mob1A) (Mob1B) (Mps one binder kinase activator like 1A)
Length: 216 Mass: 25091
Tissue specificity: Adrenal gland, bone marrow, brain, lung, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, uterus, colon with mucosa, fetal brain and fetal liver. {ECO
|
| Sequence |
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTI TDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKT ILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
|
| Structural information |
|
| Other Databases |
GeneCards: MOB1B  Malacards: MOB1B |
|
|
|
|
| Pathway id | Pathway name |
| hsa04390 | Hippo signaling pathway | | hsa04392 | Hippo signaling pathway - multiple species | |
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|