• Gene id: 92591

Gene Summary

• Gene Symbol: ASB16   Gene   UCSC   Ensembl
• Gene name: ankyrin repeat and SOCS box containing 16
• Alternate names: ankyrin repeat and SOCS box protein 16, ankyrin repeat and SOCS box-containing protein 16,
• Gene location: 17q21.31 (44170703: 44179083)     Exons: 5     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) protein
• OMIM: 615056

Protein Summary

• Protein general information: Q96NS5  
  • Name: Ankyrin repeat and SOCS box protein 16 (ASB 16)
  • Length: 453  
  • Mass: 49637
• Sequence:

  MARETFPFTSSMLRSLRLQQEWLEWEDRRRAAAQQCRSRRCPSSPRARLTRPHRSCRDPAVHQALFSGNLQQVQA
  LFQDEEAANMIVETVSNQLAWSAEQGFWVLTPKTKQTAPLAIATARGYTDCARHLIRQGAELDARVGGRAALHEA
  CARAQFDCVRLLLTFGAKANVLTEEGTTPLHLCTIPESLQCAKLLLEAGATVNLAAGESQETPLHVAAARGLEQH
  VALYLEHGADVGLRTSQGETALNTACAGAEGPGSCRRHQAAARRLLEAGADARAAGRKRHTPLHNACANGCGGLA
  ELLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPC
  VPSCETWVEAVLPELWKEHEAFYSSALCMVNQPRQLQHLARLAVRARLGSRCRQGATRLPLPPLLRDYLLLRVEG
  CIQ

• Structural information:
  • Protein Domains: (398..45-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR001496  IPR036036  
  • Prosite: PS50297 PS50088 PS50225
  • STRING: ENSP00000293414
• Other Databases: GeneCards:  ASB16  Malacards:  ASB16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq