• Gene id: 92399

Gene Summary

• Gene Symbol: MRRF   Gene   UCSC   Ensembl
• Aliases: MRFF, MTRRF, RRF
• Gene name: mitochondrial ribosome recycling factor
• Alternate names: ribosome-recycling factor, mitochondrial, ribosome-releasing factor, mitochondrial,
• Gene location: 9q33.2 (122264602: 122331336)     Exons: 11     NC_000009.12
• Gene summary(Entrez): This gene encodes a ribosome recycling factor, which is a component of the mitochondrial translational machinery. The encoded protein, along with mitochondrial elongation factor 2, functions in ribosomal recycling at the termination of mitochondrial trans
• OMIM: 604602

Protein Summary

• Protein general information: Q96E11  
  • Name: Ribosome recycling factor, mitochondrial (RRF) (Ribosome releasing factor, mitochondrial)
  • Length: 262  
  • Mass: 29277
• Sequence:

  MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKAKAKGKGQSQTRVNIN
  AALVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNMAS
  FPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDT
  VSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG

• Structural information:
  • Interpro: IPR002661  IPR023584  IPR036191  
  • PDB: 6NU2
  • PDBsum: 6NU2
  • STRING: ENSP00000343867
• Other Databases: GeneCards:  MRRF  Malacards:  MRRF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0043023	ribosomal large subunit binding	IBA	molecular function
GO:0032790	ribosome disassembly	IDA	biological process
GO:0006412	translation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)