• Gene id: 92369

Gene Summary

• Gene Symbol: SPSB4   Gene   UCSC   Ensembl
• Aliases: SSB-4, SSB4
• Gene name: splA/ryanodine receptor domain and SOCS box containing 4
• Alternate names: SPRY domain-containing SOCS box protein 4, SPRY domain-containing SOCS box protein SSB-4,
• Gene location: 3q23 (141051346: 141148610)     Exons: 5     NC_000003.12
• OMIM: 182115

Protein Summary

• Protein general information: Q96A44  
  • Name: SPRY domain containing SOCS box protein 4 (SSB 4)
  • Length: 273  
  • Mass: 30179
• Sequence:

  MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTF
  HRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLY
  HDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMR
  YINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ

• Structural information:
  • Protein Domains: (34..23-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548-)
    (234..27-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR001870  IPR013320  IPR001496  IPR036036  IPR003877  
  • Prosite: PS50188 PS50225
  • PDB: 2V24 6DN7 6DN8
  • PDBsum: 2V24 6DN7 6DN8
  • STRING: ENSP00000311609
• Other Databases: GeneCards:  SPSB4  Malacards:  SPSB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:1902916	positive regulation of protein polyubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:1990756	ubiquitin ligase-substrate adaptor activity	IPI	molecular function
GO:1990756	ubiquitin ligase-substrate adaptor activity	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042752	regulation of circadian rhythm	IMP	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq