• Gene id: 9231

Gene Summary

• Gene Symbol: DLG5   Gene   UCSC   Ensembl
• Aliases: LP-DLG, P-DLG5, PDLG
• Gene name: discs large MAGUK scaffold protein 5
• Alternate names: disks large homolog 5, discs large protein LP-DLG, discs large protein P-dlg, discs, large homolog 5, large type of P-DLG, placenta and prostate DLG,
• Gene location: 10q22.3 (77926754: 77790786)     Exons: 43     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the family of discs large (DLG) homologs, a subset of the membrane-associated guanylate kinase (MAGUK) superfamily. The MAGUK proteins are composed of a catalytically inactive guanylate kinase domain, in addition to PDZ and S
• OMIM: 604090

Protein Summary

• Protein general information: Q8TDM6  
  • Name: Disks large homolog 5 (Discs large protein P dlg) (Placenta and prostate DLG)
  • Length: 1919  
  • Mass: 213868
  • Tissue specificity: Highly expressed in normal breast tissues and low-grade breast cancer tissues (at protein level) (PubMed
• Sequence:

  MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLLAKERDHFQDLRAAL
  EKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSSLSSVGTTGKAPSPPPLLTDQQVNEKVENLS
  IQLRLMTRERNELRKRLAFATHGTAFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDF
  YHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGDLRAQQQQVLKHNGSSEILN
  KLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRLEQLGEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRR
  FEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEKYREERDAVYSEYKLIMSERDQVISELDKLQ
  TEVELAESKLKSSTSEKKAANEEMEALRQIKDTVTMDAGRANKEVEILRKQCKALCQELKEALQEADVAKCRRDW
  AFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLM
  AHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWL
  LRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVLPGSPAA
  KEGSLAVGDRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGP
  EVQAHNKRNLIQHNNSTQTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDAS
  GDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSIFD
  PNTFKRPQTPPKIDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPSTSPPSA
  LPPDVDPGEPMHASPPRKARVRIASSYYPEGDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFRPKLAP
  VVIPAQFLEEQKCVPASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSSILRNPIYTVR
  SHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSARLGSSSNLQFKAERIK
  IPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNIDTLSSCSQSQTSASTLPRIAVNPASLGERRKDRPYVEEPRH
  VKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILA
  QYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVIDPLMEQDEGPSTPPAKQSSSRIAGDANKKTLEP
  RVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDVRNKTVEEVYVEMLKPRDGVR
  LKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQ
  IPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVS
  LAYQRVQKVDCTALRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDV
  TTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQK
  LEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL

• Structural information:
  • Protein Domains: (620..71-)
    (/note="PDZ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (705..79-)
    (/note="PDZ-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (1350..142-)
    (/note="PDZ-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (-)
  • Interpro: IPR001315  IPR011029  IPR035537  IPR006907  IPR008145   IPR008144  IPR027417  IPR001478  IPR041489  IPR036034  IPR036028  IPR001452  
  • Prosite: PS50209 PS50052 PS50106 PS50002
  • CDD: cd11860
  • PDB: 1UIT
  • PDBsum: 1UIT
  • DIP: 41450
  • STRING: ENSP00000361467
• Other Databases: GeneCards:  DLG5  Malacards:  DLG5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030054	cell junction	IDA	cellular component
GO:0042130	negative regulation of T cell proliferation	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0030011	maintenance of cell polarity	IMP	biological process
GO:0035332	positive regulation of hippo signaling	IMP	biological process
GO:0060999	positive regulation of dendritic spine development	ISS	biological process
GO:0036064	ciliary basal body	ISS	cellular component
GO:0001837	epithelial to mesenchymal transition	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035331	negative regulation of hippo signaling	IMP	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0008092	cytoskeletal protein binding	IDA	molecular function
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071896	protein localization to adherens junction	IEA	biological process
GO:0065003	protein-containing complex assembly	IEA	biological process
GO:0060441	epithelial tube branching involved in lung morphogenesis	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IEA	biological process
GO:0045186	zonula adherens assembly	IEA	biological process
GO:0035331	negative regulation of hippo signaling	IEA	biological process
GO:0030901	midbrain development	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0072205	metanephric collecting duct development	IEA	biological process
GO:0060999	positive regulation of dendritic spine development	IEA	biological process
GO:0045176	apical protein localization	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0030859	polarized epithelial cell differentiation	IEA	biological process
GO:0005912	adherens junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0030159	signaling receptor complex adaptor activity	NAS	molecular function
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0098609	cell-cell adhesion	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq