• Gene id: 92292

Gene Summary

• Gene Symbol: GLYATL1   Gene   UCSC   Ensembl
• Aliases: GATF-C, GNAT
• Gene name: glycine-N-acyltransferase like 1
• Alternate names: glycine N-acyltransferase-like protein 1, acyl-CoA:glycine N-acyltransferase-like protein 1, glutamine N-acyltransferase,
• Gene location: 11q12.1 (58905397: 58957073)     Exons: 13     NC_000011.10
• OMIM: 614761

Protein Summary

• Protein general information: Q969I3  
  • Name: Glycine N acyltransferase like protein 1 (EC 2.3.1.68) (Acyl CoA:glycine N acyltransferase like protein 1) (Glutamine N acyltransferase)
  • Length: 302  
  • Mass: 35101
  • Tissue specificity: Expressed in liver and kidney and, at lower levels, in pancreas, testis, ovary and stomach. {ECO
• Sequence:

  MILLNNSHKLLALYKSLARSIPESLKVYGSVYHINHGNPFNMEVLVDSWPEYQMVIIRPQKQEMTDDMDSYTNVY
  RMFSKEPQKSEEVLKNCEIVNWKQRLQIQGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILKLNASSKSKLG
  SWAETGHPDDEFESETPNFKYAQLDVSYSGLVNDNWKRGKNERSLHYIKRCIEDLPAACMLGPEGVPVSWVTMDP
  SCEVGMAYSMEKYRRTGNMARVMVRYMKYLRQKNIPFYISVLEENEDSRRFVGQFGFFEASCEWHQWTCYPQNLV
  PF

• Structural information:
  • Interpro: IPR016181  IPR010313  IPR013652  IPR015938  
  • STRING: ENSP00000300079
• Other Databases: GeneCards:  GLYATL1  Malacards:  GLYATL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047946	glutamine N-acyltransferase activity	IBA	molecular function
GO:0006541	glutamine metabolic process	IBA	biological process
GO:0016410	N-acyltransferase activity	IBA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0047961	glycine N-acyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0047946	glutamine N-acyltransferase activity	IEA	molecular function
GO:0006541	glutamine metabolic process	IDA	biological process
GO:0047946	glutamine N-acyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq