Search Result
| Gene id | 92002 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CCNQ Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CycM, FAM58A | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | cyclin Q | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | cyclin-Q, CDK10-activating cyclin, cyclin M, cyclin-related protein FAM58A, family with sequence similarity 58 member A, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
Xq28 (153599164: 153587924) Exons: 6 NC_000023.11 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Mutations in this gene have been shown to cause an X-linked dominant STAR syndrome that typically manifests syndactyly, telecanthus and anogenital and renal malformations. The protein encoded by this gene contains a cyclin-box-fold domain which suggests i |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 300708 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8N1B3 Name: Cyclin Q (CDK10 activating cyclin) (Cyclin M) (Cyclin related protein FAM58A) Length: 248 Mass: 28369 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPYLIAMS SIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLV SLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLALQVYGVEVPAEVEAEKPWWQVFNDDL TKPIIDNIVSDLIQIYTMDTEIP | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CCNQ  Malacards: CCNQ | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||