Search Result
| Gene id | 91966 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | EOLA1 Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | CXorf40, CXorf40A | ||||||||||||||||||||||||
| Gene name | endothelium and lymphocyte associated ASCH domain 1 | ||||||||||||||||||||||||
| Alternate names | protein EOLA1, protein CXorf40A, endothelial-overexpressed lipopolysaccharide-associated factor 1, | ||||||||||||||||||||||||
| Gene location |
Xq28 (149540600: 149555344) Exons: 8 NC_000023.11 |
||||||||||||||||||||||||
| OMIM | 300954 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q8TE69 Name: Protein EOLA1 (Endothelial overexpressed lipopolysaccharide associated factor 1) (Endothelium and lymphocyte associated ASCH domain 1) Length: 158 Mass: 17891 Tissue specificity: Expressed primarily in heart, skeletal muscle, kidney, liver and placenta. Relatively high level of expression in spleen, colon and small intestine. Almost no expression in brain, thymus, lung and peripheral blood leukocytes. Expressed | ||||||||||||||||||||||||
| Sequence |
MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQALLRKG EKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEH LIPLGHEV | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: EOLA1  Malacards: EOLA1 | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||